货期
- 咨询
- 现货
- Usually dispatched within 5-10 working days
送货:
美国
Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein
Catalog Number: orb1476932
Product Overview
| Product Name | Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein |
|---|---|
| Catalog Number | orb1476932 |
| Endotoxins | Not test. |
Product Properties
| Form/Appearance | Liquid or Lyophilized powder |
|---|---|
| Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Note | For research use only. |
| Protein Sequence | MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAPAAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGVSKDEAASIKKELEEAGATVEVK |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 20.4 kDa |
| Source | E.coli |
| Biological Origin | Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) |
| Uniprot ID | Q5ZYQ1 |
Product Description
Recombinant Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12(rplL)
Application Notes
| Application Notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
|---|
Reviews
Write Your Own Review
