货期
- 咨询
- 现货
- Usually dispatched within 5-10 working days
送货:
美国
Rift valley fever virus Non-structural protein NS-S Protein
Catalog Number: orb1476901
Product Overview
| Product Name | Rift valley fever virus Non-structural protein NS-S Protein |
|---|---|
| Catalog Number | orb1476901 |
| Endotoxins | Not test. |
| Alternative Names | (click to expand) |
Product Properties
| Form/Appearance | Liquid or Lyophilized powder |
|---|---|
| Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Note | For research use only. |
| Protein Sequence | MDYFPVISVDLQSGRRVVSVEYFRGDGPPRIPYSMVGPCCVFLMHHRPSHEVRLRFSDFYNVGEFPYRVGLGDFASNVAPPPAKPFQRLIDLIGHMTLSDFTRFPNLKEAISWPLGEPSLAFFDLSSTRVHRNDDIRRDQIATLAMRSCKITNDLEDSFAGLHRMIATEAILRGIDLCLLPGFDLMYEVAHVQCVRLLQAAKEDISNAVVPNSALIVLMEESLMLRSSLPSMMGRNNWIPVIPPIPDVEMESEEESDDDGFVEVD |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 37.3 kDa |
| Source | E.coli |
| Biological Origin | Rift valley fever virus (strain ZH-548 M12) (RVFV) |
| Uniprot ID | P21698 |
Product Description
Recombinant Rift valley fever virus Non-structural protein NS-S(NSS)
Application Notes
| Application Notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
|---|
Reviews
Write Your Own Review
