货期
- 咨询
- 现货
- Usually dispatched within 5-10 working days
送货:
美国
Product Overview
| Product Name | YY1 Antibody |
|---|---|
| Catalog Number | orb610910 |
| Species/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Predicted Reactivity | Bovine |
| Conjugation | Unconjugated |
| Sensitivity | > 5000 cells |
| Tested applications | FC, ICC, IF, WB |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence. |
| Alternative Names | (click to expand) |
Product Properties
| Form/Appearance | Lyophilized |
|---|---|
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
| Note | For research use only. |
| Isotype | Rabbit IgG |
| Clonality | Polyclonal |
| MW | 44713 MW |
| Uniprot ID | P25490 |
Product Description
YY1 Antibody
Application Notes
| Dilution Range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
|---|---|
| Application Notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Validation Images 
IF analysis of YY1 using anti-YY1 antibody.
Flow Cytometry analysis of THP-1 cells using anti-YY1 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.
WB analysis using anti-YY1 antibody.Lane 1:mouse thymus tissue, Lane 2:mouse spleen tissue, Lane 3:rat thymus tissue, Lane 4:rat PC-12 cell, Lane 5:mouse RAW264.7 cell, Lane 6:PC-3 cell, Lane 7:SW620 cell.
Reviews
Write Your Own Review
